PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000437676
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 688aa    MW: 74455.3 Da    PI: 6.4
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000437676genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1661.3e-51361631128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                    l+pGfrFhPtdeelv +yLk+kv +k++++ ++i+evdiyk+ePwdL  k ++k++++e+yfFs  d+ky +g r nrat++gyWkatg+d++v++
  MDP0000437676  36 LAPGFRFHPTDEELVIYYLKRKVCRKPFKF-NAISEVDIYKSEPWDLAdKsSLKSRDQEYYFFSALDRKYGNGARMNRATNQGYWKATGNDRAVKH 130
                    579**************************9.89**************75347888999************************************** PP

            NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ +vg+kktLvf++grap+g++t+Wvmheyrl
  MDP0000437676 131 -NDFVVGMKKTLVFHSGRAPDGKRTNWVMHEYRL 163
                    .999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-5934188IPR003441NAC domain
PROSITE profilePS5100555.94836188IPR003441NAC domain
PfamPF023653.3E-2638163IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 688 aa     Download sequence    Send to blast
MGREADLQII PSAAAATIAV AAPIDPPTPP PAPTALAPGF RFHPTDEELV IYYLKRKVCR  60
KPFKFNAISE VDIYKSEPWD LADKSSLKSR DQEYYFFSAL DRKYGNGARM NRATNQGYWK  120
ATGNDRAVKH NDFVVGMKKT LVFHSGRAPD GKRTNWVMHE YRLVDEVFEK AGLGAIQDAF  180
VLCRVFHKSN IGPPNGHRYA PFVEEEWDDD DKLTLVPGQE TRSVAVVSRD AFVVGNDHAA  240
CTEQNDYAAR SEQKVHAXRS EQNDYAASSE QKVHAASSEQ KVHAARSEQN GHAAYIKGNG  300
HAAYIGGNGH AGYIGGNGHA GYIRGNGHAA YIGGXGQAAY NGENGHGTSI ERNGRGISME  360
GIDHGTSVGH GTSVKGTGHG TXGNGHSTSV KRYGHVTSVE GSGHITSVEG NGQGTSVXGN  420
GHGISVEGNV VEGIGHGTII VVDDNGTTNE GNCHETGTAG NGHSAPTAEN NIVQDTQAIS  480
KAIVVVPELP AENQTVLPPC KTERTDDYPM TCVVNREERL DDYPSPGPDD AQPLLTLFNR  540
QPGQLRQYKR RRHNESNSNH SNASEISSGM THDPCSSTTT TASTEASMTT TTRNFLSALV  600
EYQLLESLEP KDTTPAPPPE LNAALMESSV PTSCLKYIET LQTEIHKISI ERETLKFEMM  660
SAQAMINILQ ARIDLLNKEN EDLKRKV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-462819012170NAC domain-containing protein 19
3swm_B4e-462819012170NAC domain-containing protein 19
3swm_C4e-462819012170NAC domain-containing protein 19
3swm_D4e-462819012170NAC domain-containing protein 19
3swp_A4e-462819012170NAC domain-containing protein 19
3swp_B4e-462819012170NAC domain-containing protein 19
3swp_C4e-462819012170NAC domain-containing protein 19
3swp_D4e-462819012170NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.80020.0fruit| leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008345404.10.0PREDICTED: uncharacterized protein LOC103408324
TrEMBLM5XMB00.0M5XMB0_PRUPE; Uncharacterized protein
STRINGGLYMA20G33430.11e-101(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF81893241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.11e-93NAC domain containing protein 52